PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 314aa    MW: 34588.1 Da    PI: 7.6395
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041142genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l d++++ G  +W++ ++  g++R++k+c++rw +yl
      Lus10041142 14 KGPWTPEEDKILSDYIQKNGHSSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.94.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++ ++++++ lG++ W++Ia +++ gRt++++k++w+++l
      Lus10041142  67 RGKFSQDEEQTILNLHAILGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.673961IPR017930Myb domain
SuperFamilySSF466894.12E-3011108IPR009057Homeodomain-like
SMARTSM007172.8E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001672.04E-101661No hitNo description
PROSITE profilePS5129426.02662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2765117IPR009057Homeodomain-like
SMARTSM007176.6E-1666114IPR001005SANT/Myb domain
PfamPF002499.9E-1667112IPR001005SANT/Myb domain
CDDcd001674.91E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDKILSDYIQ KNGHSSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQDEEQTILN LHAILGNKWS AIAGHLPGRT DNEIKNFWNT HLKKKLIQMG  120
YDPMTHQPRT DLFATLPQLM ALVQLKDLLN LDQHNRNDDQ TTRLQAEALQ MAKLQYVQFL  180
LQSSNTTTVP PAPSLQSSGD MELINLLNSM ASSSPMINGS NTNQPLHHML LPPLSDPQVP  240
FGGTSAQITT NPTPSSWNIL PSSHTQTSVI INSPGAGRGD ASTSTSSSYA GTGTSSYWPE  300
LFLDDPILSD ISL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571465.11e-138PREDICTED: protein ODORANT1
SwissprotQ8GWP02e-76MYB39_ARATH; Transcription factor MYB39
TrEMBLB9H7321e-134B9H732_POPTR; Uncharacterized protein
STRINGPOPTR_0005s17080.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-103myb domain protein 93